PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005399
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family ARR-B
Protein Properties Length: 437aa    MW: 48910.1 Da    PI: 5.2039
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58687962PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-36813PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.95.5e-29218271155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Lsa005399 218 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKRILELMNVPGLTRENVASHLQKYRL 271
                79*******************.********************************8 PP

2Response_reg761.4e-25301381109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l++ +y e++ +  +e  l ll+e++  +D++l D+ mp+mdG++ll++i  e  +lp+i+++a ++++ + + +  Ga 
     Lsa005399  30 VLVVDDDPTCLMILEKMLKNCNY-EATICNRAEIGLSLLRENKngHDIVLSDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDSNSVVMKGVTHGAC 124
                   89*********************.***************998889**********************6654.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l++
     Lsa005399 125 DYLIKPVRIEALRN 138
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.6E-16011423IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23005.1E-4127151No hitNo description
SuperFamilySSF521725.83E-3527151IPR011006CheY-like superfamily
SMARTSM004482.4E-2928140IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011040.59929144IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.9E-2230138IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.29E-2731143No hitNo description
PROSITE profilePS5129410.59215274IPR017930Myb domain
SuperFamilySSF466894.48E-20216275IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-30217276IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-25218271IPR006447Myb domain, plants
PfamPF002491.1E-7220270IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MMLGSSCASW KPAGAGAGTV PDQFPAGLRV LVVDDDPTCL MILEKMLKNC NYEATICNRA  60
EIGLSLLREN KNGHDIVLSD VHMPDMDGFK LLEHIGLEMD LPVIMMSADD SNSVVMKGVT  120
HGACDYLIKP VRIEALRNIW QHVVRKRKHE WKDFEPEASP DVAAADAADQ HQKVPEDIDY  180
SSSANEERNW KNSKRKKDDE DEAEADAEER DESSSLKKPR VVWSVELHQQ FVAAVNQLGI  240
DKAVPKRILE LMNVPGLTRE NVASHLQKYR LYLRRLSSSQ HLGSTFLGSP DGGFASMTSF  300
TAGQFQSAVL ARSNNTKSPI SVPMMDQRNI FNFENPKLLH GIPTNMEPKQ FVGLQQSQQQ  360
QQLSYNNQIL IPVGGQTRSN GNRQPGNYRN DDLLQYPEQF NQDDLLTAIL KQQQQEAFGL  420
PENEFGFNGH GLDDLPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-22214277164ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100814.11e-167PREDICTED: two-component response regulator ARR2-like isoform X3
RefseqXP_011100813.11e-167PREDICTED: two-component response regulator ARR2-like isoform X2
RefseqXP_011100812.11e-167PREDICTED: two-component response regulator ARR2-like isoform X1
SwissprotQ940D01e-140ARR1_ARATH; Two-component response regulator ARR1
TrEMBLA0A103XZK91e-178A0A103XZK9_CYNCS; CheY-like superfamily (Fragment)
STRINGSolyc05g054390.2.11e-163(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.11e-130response regulator 1